PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S08558.10
Common NameJCGZ_00067, LOC105647239
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family G2-like
Protein Properties Length: 317aa    MW: 34091.1 Da    PI: 6.8447
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S08558.10genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like96.61.8e-30106159155
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                    +prl+Wtp+LH+rFv+av++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Jcr4S08558.10 106 RPRLVWTPQLHKRFVDAVAHL-GIKNAVPKTIMQLMSVDGLTRENVASHLQKYRL 159
                    59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.14E-20103163IPR009057Homeodomain-like
PROSITE profilePS5129411.059103162IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-30105164IPR009057Homeodomain-like
TIGRFAMsTIGR015573.5E-24107159IPR006447Myb domain, plants
PfamPF002491.2E-7109158IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MREDDSNWFS RWEEELPSPE ELMPLSQTLI TPDLALAFDI RNPTNTTVNN TSLQQNPPPP  60
PPPPPPTSTT PSPLPPSQPN SAEYAADSAD LGSGAAGDEP ARTLKRPRLV WTPQLHKRFV  120
DAVAHLGIKN AVPKTIMQLM SVDGLTRENV ASHLQKYRLY LKRMQGLSSG GAGGVNGTGA  180
GAGAGLTAGD AATEHLFASS PVPPHFLHPG RPNSDHFLPY VPVAALQHHH HQQQMAAAAA  240
AVAHPQLQNQ YHRQMGHFGS PQNGQFEHPF LARQAQQPVH RMGAPVQNTV PGYVEDLESA  300
NGSGGRKVLT LFPTGDD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-20105164463ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2134147e-38AC213414.1 Populus trichocarpa clone POP015-I11, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012088642.10.0PREDICTED: transcription factor PCL1-like
TrEMBLA0A067JV010.0A0A067JV01_JATCU; Uncharacterized protein
STRINGPOPTR_0006s03340.11e-145(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85423045
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10760.11e-79G2-like family protein
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]